Comprehensive Guide to GLP-1 (7-36) Amide 5mg: Incretin Peptide Structure, Metabolic Research Standards, and Analytical Purity
Welcome to Suzhou Lanhai Peptide, your trusted global source for advanced synthetic peptides, amino acid derivatives, and specialized laboratory storage solutions. In modern pharmaceutical synthesis, metabolic disease research, and advanced endocrinology, investigating endogenous incretin hormones requires absolute precision, verifiable purity, and strict compliance with research standards. When exploring glucose-dependent insulin secretion, pancreatic beta-cell protection, and central satiety pathways, utilizing high-purity GLP-1 (7-36) Amide 5mg is vital for achieving reproducible scientific outcomes.
This comprehensive guide explores the structural sequence, biochemical properties, analytical verification standards, and proper laboratory storage protocols for GLP-1 5mg. By examining real-world industry benchmarks and analytical chemistry standards, we outline why optimized sourcing and handling are fundamental to advanced metabolic research.
1. Understanding GLP-1 (7-36) Amide: Structure, Mechanism, and Research Scope
Glucagon-Like Peptide-1 (7-36) Amide is the primary biologically active endogenous form of GLP-1 circulating in humans. Derived from the tissue-specific post-translational processing of proglucagon, it is structured as a 30-amino acid peptide with an amidated C-terminus: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2.
The Mechanism of Action in Biomedical Research
In contemporary biochemical and pharmacological investigations, GLP-1 is examined for several key cellular pathways:
-
GLP-1 Receptor Activation: GLP-1 binds selectively to the GLP-1 receptor (GLP-1R), a G protein-coupled receptor located on pancreatic beta cells, stimulating intracellular adenylyl cyclase and cyclic AMP (cAMP) production.
-
Glucose-Dependent Insulinotropic Action: Research investigates its role in enhancing glucose-stimulated insulin secretion while simultaneously suppressing glucagon release from alpha cells in a glucose-dependent manner, minimizing hypoglycemia risks.
-
Gastric Emptying and Satiety Studies: In vitro and animal model studies evaluate its central nervous system signaling in the hypothalamus, focusing on gastric motility regulation and satiety pathway modulation.
-
Enzymatic Degradation and Half-Life: Because native GLP-1 has a very short half-life due to rapid cleavage by dipeptidyl peptidase-4 (DPP-4), laboratory investigations frequently study structural analogs or DPP-4 inhibitor co-administrations to enhance peptide stability.
2. Analytical Verification and High-Purity Synthesis Standards
For institutional buyers, academic researchers, and biotechnology procurement managers, batch verification is paramount. Synthetic intermediate-length incretins require rigorous solid-phase peptide synthesis (SPPS) and HPLC purification to ensure structural integrity and proper C-terminal amidation.
High-Performance Liquid Chromatography (HPLC)
Every batch of GLP-1 5mg distributed by Suzhou Lanhai Peptide undergoes rigorous verification via HPLC to guarantee purity levels exceeding 98% to 99%+, ensuring minimal synthetic impurities or truncated peptide fragments.
Mass Spectrometry (MS) Validation
Mass spectrometry confirms the exact molecular weight and amino acid sequence fidelity, ensuring that the synthesized 30-amino acid amide matches theoretical molecular profiles precisely.
Technical Specification Comparison
| Specification Parameter | Standard Research Grade | Premium Analytical Grade |
| Sequence Identity | GLP-1 (7-36) Amide | GLP-1 (7-36) Amide |
| Purity (HPLC) | $\ge 98.0\%$ | $\ge 99.2\%$ |
| Mass Spectrometry (MS) | Verified Molecular Weight | Verified Molecular Weight |
| Formulation | 5mg Lyophilized Powder | 5mg Lyophilized Powder |
| Storage Conditions | $-20^\circ C$ desiccated | $-20^\circ C$ desiccated |
3. Laboratory Handling, Reconstitution, and Storage Protocols
Synthetic peptides like GLP-1 are supplied as stabilized, vacuum-freeze-dried (lyophilized) powders to maximize shelf-life stability. Proper laboratory handling is essential to preserve peptide integrity upon reconstitution.
Reconstitution Best Practices
-
Solvent Selection: Reconstitute lyophilized GLP-1 5mg using bacteriostatic water for injection or sterile analytical buffers in a clean laminar flow hood.
-
Avoiding Shear Stress: Introduce solvents gently down the inside wall of the vial rather than forcefully spraying liquid directly onto the lyophilized cake to prevent peptide bond shearing.
Cold-Chain Storage Guidelines
-
Dry Powder Storage: Store sealed vials of lyophilized GLP-1 at $-20^\circ C$ desiccated away from light and moisture.
-
Reconstituted Storage: Once reconstituted, solutions should be kept between $2^\circ C$ and $8^\circ C$ and utilized within short-term experimental windows to prevent enzymatic degradation or deamidation.
4. Mandatory Research Disclaimer and Compliance
-
For Laboratory and Research Use Only: All peptide products offered by Suzhou Lanhai Peptide, including GLP-1 5mg, are strictly intended for in vitro laboratory research, analytical testing, and scientific study. They are not approved for human consumption, clinical trials on humans, veterinary use, or therapeutic self-administration.
5. Frequently Asked Questions (FAQs)
1. What is the exact amino acid sequence of GLP-1 supplied here?
Our research grade product is GLP-1 (7-36) Amide, representing the primary active endogenous 30-amino acid sequence with an amidated C-terminus.
2. What purity level does Suzhou Lanhai Peptide guarantee for GLP-1 5mg?
Every batch of GLP-1 5mg is backed by analytical documentation confirming an HPLC purity rating of 98% to 99% or higher.
3. How should lyophilized GLP-1 5mg be stored prior to reconstitution?
Lyophilized powder vials should be stored in a sealed, dry container at $-20^\circ C$ to maintain structural stability and prevent thermal degradation.
4. Are Certificates of Analysis (COAs) provided with orders?
Yes. Every order includes or provides access to batch-specific HPLC and Mass Spectrometry reports to verify purity and molecular weight for institutional compliance.
5. Can native GLP-1 be used in human clinical applications?
No. All products sold by Suzhou Lanhai Peptide are restricted strictly to laboratory research and development use only and are prohibited from human or clinical application.




Reviews
There are no reviews yet.