VIP 10mg

Comprehensive Guide to VIP 10mg (Vasoactive Intestinal Peptide): Neuropeptide Structure, Vasodilatory Research Standards, and Analytical Purity

Welcome to Suzhou Lanhai Peptide, your trusted global source for advanced synthetic peptides, amino acid derivatives, and specialized laboratory storage solutions. In modern neuroendocrinology research, vasodilation pathway studies, and advanced pharmaceutical formulation research, investigating endogenous neuropeptides requires absolute precision, verifiable purity, and strict compliance with research standards. When exploring VIP receptor activation, bronchodilation mechanics, and neuroprotective signaling, utilizing high-purity VIP 10mg (Vasoactive Intestinal Peptide) is vital for achieving reproducible scientific outcomes.

This comprehensive guide explores the structural sequence, biochemical properties, analytical verification standards, and proper laboratory storage protocols for VIP 10mg. By examining real-world industry benchmarks and analytical chemistry standards, we outline why optimized sourcing and handling are fundamental to advanced physiological and immunological research.

1. Understanding VIP: Structure, Mechanism, and Research Scope

Vasoactive Intestinal Peptide (VIP) is a naturally occurring, 28-amino acid neuropeptide belonging to the glucagon/secretin superfamily. Its conserved primary amino acid sequence (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2) is engineered to interact with specific G-protein-coupled receptors, namely VPAC1 and VPAC2, distributed widely across central nervous, cardiovascular, and immune tissues.

The Mechanism of Action in Biomedical Research

In contemporary biochemical and pharmacological investigations, VIP is examined for several key cellular pathways:

• VPAC1 and VPAC2 Receptor Agonism: VIP binds selectively to VPAC1 and VPAC2 receptors, activating adenylate cyclase and stimulating intracellular cyclic AMP (cAMP) accumulation to drive downstream physiological responses.

• Vasodilatory and Smooth Muscle Relaxation: Research highlights its potent role in relaxing vascular, respiratory, and gastrointestinal smooth muscle tissues through endothelium-independent mechanisms.

• Neuroprotection and Immunomodulation: In vitro and animal model research evaluates its anti-inflammatory properties, exploring how VIP down-regulates pro-inflammatory cytokines while supporting neuronal survival and glial cell regulation.

2. Analytical Verification and High-Purity Synthesis Standards

For institutional buyers, academic researchers, and biotechnology procurement managers, batch verification is paramount. Long-chain neuropeptides containing multiple reactive amino acid residues require rigorous solid-phase peptide synthesis (SPPS) and HPLC purification to prevent deletion sequences or oxidation byproducts.

High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS)

Every batch of VIP 10mg distributed by Suzhou Lanhai Peptide undergoes rigorous verification via HPLC and MS to guarantee purity levels exceeding 98% to 99%+, ensuring minimal synthetic impurities or truncated peptide fragments.

Technical Specification Comparison

3. Laboratory Handling, Reconstitution, and Storage Protocols

Synthetic peptides like VIP are supplied as stabilized, vacuum-freeze-dried (lyophilized) powders to maximize shelf-life stability. Proper laboratory handling is essential to preserve peptide integrity upon reconstitution.

Reconstitution Best Practices

• Solvent Selection: Reconstitute lyophilized VIP 10mg using sterile bacteriostatic water for injection or analytical buffer solutions in a clean laminar flow hood.

• Avoiding Shear Stress: Introduce solvents gently down the inside wall of the vial rather than forcefully spraying liquid directly onto the lyophilized cake to prevent peptide bond shearing.

Cold-Chain Storage Guidelines

• Dry Powder Storage: Store sealed vials of lyophilized VIP at $-20^\circ C$ desiccated away from light and moisture.

• Reconstituted Storage: Once reconstituted, solutions should be kept between $2^\circ C$ and $8^\circ C$ protected from light and utilized within short-term experimental windows to prevent enzymatic degradation or oxidation of sensitive residues.

4. Mandatory Research Disclaimer and Compliance

• For Laboratory and Research Use Only: All peptide products offered by Suzhou Lanhai Peptide, including VIP 10mg, are strictly intended for in vitro laboratory research, analytical testing, and scientific study. They are not approved for human consumption, clinical trials on humans, veterinary use, or therapeutic self-administration.

5. Frequently Asked Questions (FAQs)

1. What is the precise amino acid sequence length of VIP?

VIP is a 28-amino acid linear neuropeptide featuring a C-terminal amide group, classified within the secretin/glucagon peptide family.

2. What purity level does Suzhou Lanhai Peptide guarantee for VIP 10mg?

Every batch of VIP 10mg is backed by analytical documentation confirming an HPLC purity rating of 98% to 99% or higher.

3. How should lyophilized VIP 10mg be stored prior to reconstitution?

Vials of dry powder should be stored tightly sealed in a dry environment at $-20^\circ C$ protected from light to maintain structural stability.

4. Are Certificates of Analysis (COAs) provided with orders?

Yes. Every order includes or provides access to batch-specific HPLC and Mass Spectrometry reports to verify purity and molecular weight for institutional compliance.

5. Can VIP be used in human clinical applications?

No. All products sold by Suzhou Lanhai Peptide are restricted strictly to laboratory research and development use only and are prohibited from human or clinical application.