VIP 5mg

Comprehensive Guide to VIP 5mg (Vasoactive Intestinal Peptide): Neuropeptide Structure, Immunological Research Standards, and Analytical Purity

Welcome to Suzhou Lanhai Peptide, your trusted global source for advanced synthetic peptides, amino acid derivatives, and specialized laboratory storage solutions. In modern neuroendocrinology research, mucosal immunology studies, and advanced pharmaceutical formulation research, investigating targeted vasoactive neuropeptides requires absolute precision, verifiable purity, and strict compliance with research standards. When exploring VIP receptor signaling, anti-inflammatory cytokine modulation, and neuroprotective pathways, utilizing high-purity VIP 5mg (Vasoactive Intestinal Peptide) is vital for achieving reproducible scientific outcomes.

This comprehensive guide explores the structural sequence, biochemical properties, analytical verification standards, and proper laboratory storage protocols for VIP 5mg. By examining real-world industry benchmarks and analytical chemistry standards, we outline why optimized sourcing and handling are fundamental to advanced neurological and immunological research.

1. Understanding VIP: Structure, Mechanism, and Research Scope

Vasoactive Intestinal Peptide (VIP) is a 28-amino acid neuropeptide that functions as a hormone and neurotransmitter. Its specific primary amino acid sequence (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2) binds to specific G protein-coupled receptors—primarily VPAC1 and VPAC2—distributed widely throughout the central nervous system, gastrointestinal tract, and immune cells.

The Mechanism of Action in Biomedical Research

In contemporary biochemical and pharmacological investigations, VIP is examined for several key cellular pathways:

• VPAC1 and VPAC2 Receptor Activation: VIP binding stimulates adenylate cyclase activity, leading to intracellular increases in cyclic AMP (cAMP) and subsequent activation of protein kinase A (PKA) signaling cascades.

• Anti-Inflammatory and Immunomodulatory Signaling: Research demonstrates that VIP acts as a potent endogenous anti-inflammatory agent, suppressing the production of pro-inflammatory cytokines (such as TNF-$\alpha$, IL-6, and IL-12) while promoting regulatory T-cell responses in experimental models.

• Neuroprotection and Circadian Regulation: In vitro and animal model research evaluates its capacity to protect neuronal populations from excitotoxic damage, modulate cerebral blood flow, and participate in the synchronization of circadian rhythms within the suprachiasmatic nucleus.

2. Analytical Verification and High-Purity Synthesis Standards

For institutional buyers, academic researchers, and biotechnology procurement managers, batch verification is paramount. 28-amino acid regulatory peptides require rigorous solid-phase peptide synthesis (SPPS), C-terminal amidation, and high-performance liquid chromatography (HPLC) purification to ensure exact sequence alignment and structural integrity.

High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS)

Every batch of VIP 5mg distributed by Suzhou Lanhai Peptide undergoes rigorous verification via HPLC and MS to guarantee purity levels exceeding 98% to 99%+, ensuring minimal synthetic impurities or truncated peptide sequences.

Technical Specification Comparison

3. Laboratory Handling, Reconstitution, and Storage Protocols

Synthetic peptides like VIP are supplied as stabilized, vacuum-freeze-dried (lyophilized) powders to maximize shelf-life stability. Proper laboratory handling is essential to preserve peptide integrity upon reconstitution.

Reconstitution Best Practices

• Solvent Selection: Reconstitute lyophilized VIP 5mg using sterile bacteriostatic water for injection or analytical buffer solutions in a clean laminar flow hood.

• Avoiding Shear Stress: Introduce solvents gently down the inside wall of the vial rather than forcefully spraying liquid directly onto the lyophilized cake to prevent peptide bond shearing.

Cold-Chain Storage Guidelines

• Dry Powder Storage: Store sealed vials of lyophilized VIP at $-20^\circ C$ desiccated away from light and moisture.

• Reconstituted Storage: Once reconstituted, solutions should be kept between $2^\circ C$ and $8^\circ C$ protected from light and utilized within short-term experimental windows to prevent enzymatic degradation.

4. Mandatory Research Disclaimer and Compliance

• For Laboratory and Research Use Only: All peptide products offered by Suzhou Lanhai Peptide, including VIP 5mg, are strictly intended for in vitro laboratory research, analytical testing, and scientific study. They are not approved for human consumption, clinical trials on humans, veterinary use, or therapeutic self-administration.

5. Frequently Asked Questions (FAQs)

1. What is the primary biological function of VIP?

VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide that regulates vasodilation, smooth muscle relaxation, epithelial fluid secretion, and potent anti-inflammatory immune responses via VPAC1 and VPAC2 receptors.

2. What purity level does Suzhou Lanhai Peptide guarantee for VIP 5mg?

Every batch of VIP 5mg is backed by analytical documentation confirming an HPLC purity rating of 98% to 99% or higher.

3. How should lyophilized VIP 5mg be stored prior to reconstitution?

Vials of dry powder should be stored tightly sealed in a dry environment at $-20^\circ C$ protected from light to maintain structural stability.

4. Are Certificates of Analysis (COAs) provided with orders?

Yes. Every order includes or provides access to batch-specific HPLC and Mass Spectrometry reports to verify purity and molecular weight for institutional compliance.

5. Can VIP be used in human clinical applications?

No. All products sold by Suzhou Lanhai Peptide are restricted strictly to laboratory research and development use only and are prohibited from human or clinical application.